Kryptos K4: What it is, how the mystery was born, and why it still refuses to give up.

Last update: 27/10/2025
Author Isaac
  • The Kryptos sculpture hides four messages; three have been solved, and K4 remains with 97 characters and clues like “BERLIN CLOCK.”
  • Theories have been proposed (double Vigenère, rotations and grids) and none have been verified by public cryptanalysis.
  • Sanborn auctions K4 manuscript and pleads for a “secret keeper” amid Smithsonian archival find.
  • Kryptos is already a cultural icon that unites art, cryptography, and community, with the possible yet-to-be-discovered K5.

Kryptos sculpture and K4 code

In Langley Gardens, across from CIA headquarters, stands a sculpture that has turned secrecy into an art: Kryptos. Since 1990, its fourth passage, The famous K4 has been a headache for spies, mathematicians and amateurs. to the puzzles. Three sections have already yielded to human ingenuity; the last, however, has withstood decades of attempts. And yet, recently there has been an unexpected twist: The contents of K4 were allegedly exposed due to archival carelessness., while the cryptographic method remains unconfirmed.

In parallel with the global obsession, the author himself, Jim Sanborn, has decided to change the rules of the game. The auction of the K4 handwritten text has been launched, with RR Auction as the auction house and a date set for November 20. Estimates range from $300.000 to $500.000 (some media outlets were talking about 280.000 to 470.000euros), with part of the funds earmarked for social purposes. Sanborn even expressed his desire for the winner to act as “keeper of the secret” and not necessarily make it public.

What is Kryptos, where does it come from, and why it baffled even the CIA?

Kryptos K4 in the CIA

In the late 1980s, the CIA commissioned Jim Sanborn to create a work for its Langley campus that would symbolize the intersection of art, knowledge, and hidden messages. In developing Kryptos, the artist relied on Edward Scheidt, agency cryptographer, to devise encryption systems that were not trivial. The result was a sculptural ensemble with a curved copper sheet in the shape of an "S", about four meters high, accompanied by stones and fragments with partially buried Morse code.

The centerpiece features hundreds of perforated characters. The most frequently cited figures speak of 1.735 encrypted letters in total, although there are descriptions of the main panel that mention 865 engravings. Beyond the dance of numbers, the essential thing is that these letters are distributed in four independent sections or passages (K1, K2, K3 and K4), each with Classical cryptographic methods and increasing difficultySanborn, convinced that the CIA would solve it in less than a decade, underestimated the depth of the enigma.

The social phenomenon surrounding Kryptos has not been minor: Entire communities have spent years trying to decipher it., exploring everything from the frequency of letters to geometric interpretations of the sculpture itself. It has even been suggested that certain spelling errors are deliberate and part of the game. Not surprisingly, the work has appeared in novels such as “The Lost Symbol” and in countless articles and forums.

Structure of the cryptogram and the three already solved passages (K1–K3)

The first segment, K1, was solved with a modified Vigenère method and offers a poetic wink: “between subtle shading and the absence of light the nuance of 'iqlusion' can be guessed”, with that error found in the word “illusion”. That the alphabet is “keyboarded” by the word KRYPTOS and that keys such as PALIMPSEST and ABSCISSA have played a role in K1 and K2 is now part of the codebreakers' heritage.

In K2 there is a reference to information buried somewhere in Langley and the element appears “WW”, widely interpreted as a reference to William H. Webster, director of the CIA at the time. This passage reinforced the idea that the work dialogues with its own physical location, establishing a game of clues between text and environment.

  How to protect Windows 11 from ransomware step by step

The third segment, K3, cites archaeologist Howard Carter's diary about the opening of Tutankhamun's tomb, and its decipherment required a leap in complexity. Among those who contributed to solving the first segments are David Stein, CIA analyst, and Jim Gillogly, a Californian computer scientist, whose work cemented the community's enthusiasm.

These three decipherments set the bar very high for the fourth block. If the first pieces were “accessible” to those who mastered the basics, K3 already called for a more sophisticated approach, and everything indicated that K4 would go a step further.

K4, the disputed passage that refuses to fall

The final section, K4, is a chain of 97 characters (some count 98 if they consider a link question mark) which has literally withstood the CIA, the NSA, and thousands of enthusiasts around the world. Its ciphertext, known to all comers, is: OBKRUOXOGHULBSOLIFBBWFLRVQQPRNGKSSOTWTQSJQSSEKZZWATJKLUDIAWINFBNYPVTTMZFPKWGDKZXTJCDIGKUHUAUEKCAR.

Sanborn himself, aware of the trap, has dropped hints sparingly. Among the most famous are “BERLIN CLOCK” (Berlin Clock) and “EAST NORTHEAST” (East northeast). The importance of some displaced letters in the upper left corner of the sculpture has also been highlighted: DYAHR, a rarity that many link to the trigger for the decryption.

The general suspicion is that K4 does not depend on a regular key. You could combine several techniques in sequence, which complicates the search for patterns and turns the problem into a "puzzle within a puzzle." Despite the passage of time, no one has provided a complete solution verifiable by public cryptanalysis.

Signs, physical anomalies and how sculpture also communicates

In addition to textual clues, Kryptos incorporates information into the space itself. Copper panels, stones, and fragments of Morse half-buried are part of the language of the work. There are those who argue that the arrangement of the letters, its geometry and the small “faults” They are winks to guide the decoder.

The DYAHR anomaly, for example, is often cited as a “marker” to align some encryption process or layer. There is a persistent hypothesis in the community that Each passage offers clues to the next, so K1 would help K2, and so on, culminating in K4.

For decades, Sanborn has cautiously nurtured the mystery. In fact, it has come to $50 fee for reviewing alleged solutions, and according to his own words, in peak years that filter could have earned him around $40.000. For those who have had to install panic buttons, sensors and cameras after receiving threats, it's not just a game.

Popular theories: double Vigenère, “YA” and “R”, and a 14x53 grid

One of the most discussed approaches in recent forums proposes a double layer of Vigenère. First, a clue from a Delaware travelogue of the 1860s—a phrase that would fit as an answer to the final question in passage K3 (“Can you see anything?”)—and then a second clue that would be a mathematical sequence of letters with a constant displacement, starting at the DYAHR anomaly.

Those who have explored this line maintain that this explains the official clues (“EAST NORTHEAST” and “BERLIN CLOCK”), and they ensure that meaningful expressions emerge, such as “FORTY YARDS”, “HOURHAND,” “RAID OVER,” or “LAYS AS IT.” The challenge, they acknowledge, is pinpointing that second key, which “should be hidden in the rest of the sculpture.” The procedure was summarized in a personal blog (https://kryptos-k4.blogspot.com/) and in a short article, seeking fresh perspectives that would complete the puzzle.

  More secure encryption and hashing algorithms: a complete guide

Another particularly creative approach took as its starting point that the superscripts “YA” and “R” are “important.” A researcher located that sequence again—this time vertically—and wondered if it was necessary to rotate 90 degrees clockwise a section of text to overlap K4. By removing three question marks (as occurs in K1 and K2) and arranging the 742 characters remaining in a 14x53 grid, the lineup matched after the rotation.

The experiment yielded a 97-character “key string”: VLPFTLIAPDRFGMTAETMNGNYDLAMPQQVRQUXDOTEIDMIYHAETETEAOUYSEJDYFPRUAHHRECENAOEHYIFNWLTSLSRTGQAMNGMEH. The finding was striking because the 5-gram appears in K4. RVQQP and in that chain you can see its inverse, PQQVR, crossing at the same “P”. Someone calculated the probability of that 5-gram arising at random, and estimated it at around 1 out of 11.881.376, always under assumptions of independence and randomness.

This opened up three hypotheses: pure coincidence, inevitable effect of encryption or track inserted on purpose by the authorThe researcher himself requested a second academic opinion and finally consulted Sanborn, paying the fee. The response was blunt: it was a coincidence. Despite the cold shower, the idea of ​​stacking layers (“LAYER TWO”), of rely on rotations —like those used in K3— or flirting with the steganography (tracks like “IT WAS TOTALLY INVISIBLE” or “VIRTUALLY… INVISIBLE” have given rise to this) continues to haunt code hunters.

In that same exchange, another curiosity of the workshop came to light: K3, it is said, came to have 743 characters and Sanborn reportedly removed an “S,” leaving it at 742 for aesthetic reasons. Some wondered if, in fact, It would have been made to fit “well” on the gridA cryptic phrase, "T IS YOUR POSITION," was even included as a possible opening nod. As a nice touch, several of these proposals ended with a message in ROT13: “V sbyybjrq gur ehyrf”.

The auction, the figure of the "guardian" and the mess over the discovery in the archive

Sanborn has lived with the pressure of secrecy for 35 years. In a letter to his followers, he acknowledged that “the burden of keeping secrets” pesa, that he no longer has "physical, mental or financial resources" to maintain this dynamic and that he would prefer that the winner of the auction will preserve the mystery“Power lies in a secret, not in its absence,” he wrote, emphasizing that if the buyer doesn’t keep it, “what’s the point?”

The sale, scheduled for November 20, includes the original handwritten text by K4 and associated materials. RR Auction, whose vice president Bobby Livingston has gone so far as to say that the ideal outcome would be for the winner to act as “keeper of the secret,” estimates that could reach between $300.000 and $500.000, with a portion earmarked for programs for people with disabilities. Some Spanish media outlets spoke of euro brackets and emphasized the idea that The buyer would decide whether to reveal the message or keep it..

In the midst of these preparations, journalists Jarett Kobek and Richard Byrne found, they say, the K4 plaintext at the SmithsonianWhile reviewing papers related to the auction, they located "coding tables" donated to the museum; by photographing and reconstructing fragments, they saw the message emerge—with the clues "BERLIN CLOCK" and "EAST NORTHEAST" embedded within. Sanborn admitted the authenticity of the material and explained that it would have been a mistake to include it in those files while he was being treated for cancer.

After that, the Smithsonian restricted access for 50 years (until 2075). There was tension: RR Auction warned of legal action if the text was published; Sanborn proposed confidentiality agreements and even a percentage of the sale, proposals that journalists rejected as inappropriate. The auction, however, continued, and the debate shifted to subtler territory: Knowing the content is not equivalent to solving cryptographically The enigma as it was conceived. Elonka Dunin and others insist on this distinction between "what it says" and "how it came to be."

  What is cryptojacking and how to protect yourself from this attack

The controversy, paradoxically, has rekindled interest. For some, Kryptos is “worth” its mysteryFor others, the story of the discovery may enhance the work's value. Meanwhile, Sanborn drops another hook: there is a K5 and “it will also be inscrutable.” The scene is left open.

Cryptos as a cultural icon: art, cryptography, and technology

Kryptos's magnetism overflows beyond the CIA's reach. There are periodic conferences, forums, and meetings just to discuss the piece. Professor Peter Krapp describes the phenomenon as a mixture of a duel of wits, a testing ground for programs and Emotional bond of cryptology veterans with his old discipline. In his opinion, privatizing the auction solution is "sad and logical at the same time": ideally, knowledge should be shared, especially when several people were involved in its design.

La Artificial Intelligence hasn't hit the right note either. Sanborn comments that he has received responses generated by ChatGPT that seemed “ridiculous” to him. In parallel, he has designed tools to manage the flood of submissions: from charging for reviewing proposals to working on a telephone line with IA to answer those who call, probably in his own voice. All in an attempt to bring order to a passion that sometimes overflows.

The physical dimension of the work also deserves mention: Sanborn recalls “much blood and treasure” invested in hauling tons of stone through standard doors, at night and on weekends, and carving more than 1.700 characters with the help of nine assistants. The CIA commissioned Kryptos as part of a artistic program that sought to soften its image after the Cold War, and the result has been, in terms of reputation, an undeniable boost in visibility.

In the history of modern decryption, Kryptos is already rubbing shoulders with legends such as Enigma for its ability to keeping popular curiosity alive for decades. Reference resources, from pages like Elonka's to historical archives (Realm of Twelve or Kryptoslogia, now with broken links), have nurtured a community that continues to grow. In Spain, technology and popular culture media have followed every twist and turn of the story, from the passing of clues "northeast"And"Berlin clock" to the controversy over the auction.

Regardless of whether or not K4's text is published, the essential remains: Kryptos was born to remind us that the visible and the hidden coexist, that the how matters as much as the what, and that a good question can hold the world's attention for thirty-five years. If one day everything becomes clear—including that possible K5—the journey to get there will have been, in itself, part of the work.

Anyone who approaches Kryptos today will find a multi-layered enigma: one history of public art, a cryptographic challenge still open in the strictest sense, a case study on archives and knowledge preservation, and a community determined to keep pulling the thread. With the echo of “BERLIN CLOCK”, “EAST NORTHEAST”, the letters DYAHR and that chain that begins with OBKRUOXO…, Sanborn's piece confirms something that never expires: the power of a well-posed secret.